General Information

  • ID:  hor005582
  • Uniprot ID:  Q5NVR8
  • Protein name:  Hepcidin
  • Gene name:  HAMP
  • Organism:  Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
  • Family:  Hepcidin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pongo (genus), Ponginae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006879 intracellular iron ion homeostasis; GO:0007165 signal transduction; GO:0042742 defense response to bacterium
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DTHFPIYIFCCGCCHRSKCGMCCKT
  • Length:  25(60-84)
  • Propeptide:  MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARAGWTPMLQRRRRRDTHFPIYIFCCGCCHRSKCGMCCKT
  • Signal peptide:  MALSSQIWAACLLLLLLLASLTSG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  10-13; 11-19; 14-22
  • Structure ID:  AF-Q99MH3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005582_AF2.pdbhor005582_ESM.pdb

Physical Information

Mass: 328573 Formula: C119H182N34O32S8
Absent amino acids: AELNQVW Common amino acids: C
pI: 8.05 Basic residues: 5
Polar residues: 13 Hydrophobic residues: 4
Hydrophobicity: 23.6 Boman Index: -2375
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 31.2
Instability Index: 3776 Extinction Coefficient cystines: 1865
Absorbance 280nm: 77.71

Literature

  • PubMed ID:  NA
  • Title:  NA